DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and AT5G09340

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_196496.1 Gene:AT5G09340 / 830793 AraportID:AT5G09340 Length:79 Species:Arabidopsis thaliana


Alignment Length:48 Identity:14/48 - (29%)
Similarity:21/48 - (43%) Gaps:5/48 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMH 66
            |..|||::.:.|.|.|..:......|.....|...|||:     |::|
plant    12 KYCVEVEKTTTIADMKTKIYDATGMENAYQYLEHRGKIV-----LEVH 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 14/48 (29%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
AT5G09340NP_196496.1 Ubl_ubiquitin_like 3..72 CDD:340559 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.