DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and AT4G05230

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_192432.1 Gene:AT4G05230 / 825871 AraportID:AT4G05230 Length:206 Species:Arabidopsis thaliana


Alignment Length:148 Identity:32/148 - (21%)
Similarity:55/148 - (37%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TVEVDEDSGIKDFKILVAQKFE----AEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLVIKAP 81
            |.|:  :.|..|..:.:.||.|    ....:..|:|.|.:::|...::...|.::..:.|.|.:|
plant    12 TFEI--ELGYWDTVLEIKQKIEKYQRIPVSKQTLLFQGNVLQDHLDIEQCVILNHSRIQLSISSP 74

  Fly    82 --TRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMD 144
              :|||.|           .|...||          ..||:         .|..:||....::|.
plant    75 DQSRNNIQ-----------VFKTEQF----------PQSNS---------TEQTSNGHHESTVMI 109

  Fly   145 NPMVQQMMNNPDTMRQLI 162
            ........|||..:|.::
plant   110 PMSNNNNNNNPKKLRVMV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 13/61 (21%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
AT4G05230NP_192432.1 ubiquitin 3..72 CDD:459726 13/61 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.