DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and faub

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001017866.2 Gene:faub / 550564 ZFINID:ZDB-GENE-050417-416 Length:133 Species:Danio rerio


Alignment Length:45 Identity:12/45 - (26%)
Similarity:21/45 - (46%) Gaps:6/45 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VEVDED-----SGIKDFKIL-VAQKFEAEPEQLVLIFAGKIMKDT 60
            :.:::|     |||::|..| |:.:.........|..|||:...|
Zfish    46 IPLEDDALICQSGIEEFNTLEVSSRLLGGKVHGSLARAGKVRGQT 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 12/45 (27%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
faubNP_001017866.2 Ubl_FUBI 1..74 CDD:340491 7/27 (26%)
Ribosomal_S30 75..132 CDD:398432 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.