powered by:
Protein Alignment Ubqn and faub
DIOPT Version :9
Sequence 1: | NP_001285457.1 |
Gene: | Ubqn / 32977 |
FlyBaseID: | FBgn0031057 |
Length: | 547 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017866.2 |
Gene: | faub / 550564 |
ZFINID: | ZDB-GENE-050417-416 |
Length: | 133 |
Species: | Danio rerio |
Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
Similarity: | 21/45 - (46%) |
Gaps: | 6/45 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 VEVDED-----SGIKDFKIL-VAQKFEAEPEQLVLIFAGKIMKDT 60
:.:::| |||::|..| |:.:.........|..|||:...|
Zfish 46 IPLEDDALICQSGIEEFNTLEVSSRLLGGKVHGSLARAGKVRGQT 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.