Protein Alignment Ubqn and NEDD8

DIOPT Version :9

• Sequence 1: NP_001285457.1
• Gene: Ubqn / 32977
• FlyBaseID: FBgn0031057
• Length: 547
• Species: Drosophila melanogaster
• Sequence 2: NP_006147.1
• Gene: NEDD8 / 4738
• HGNCID: 7732
• Length: 81
• Species: Homo sapiens
• Alignment Length: 69
• Identity: 20/69 - (28%)
• Similarity: 35/69 - (50%)
• Gaps: 1/69 - (1%)

  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....::..|..|.:|....|:|..||::||.|.|..|...:.|.....:
Human     3 IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL 67

  Fly    75 HLVI 78
            |||:
Human    68 HLVL 71

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
Ubqn	NP_001285457.1	UBQ	9..79	CDD:214563	20/69 (29%)
		hPLIC_N	9..79	CDD:176403	20/69 (29%)
		STI1	322..368	CDD:128966
		UBA_PLICs	501..537	CDD:270582
NEDD8	NP_006147.1	Ubl_NEDD8	3..76	CDD:340504	20/69 (29%)
		Interaction with UBE1C	70..72		1/2 (50%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900