DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and CG10694

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster


Alignment Length:287 Identity:60/287 - (20%)
Similarity:101/287 - (35%) Gaps:101/287 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DKKTV--EVDEDSGIKDFKILVAQKFEAEP------EQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            |::|:  |::|...::..|    ||....|      |.|.||::|:||:|...|..:.|.::..:
  Fly     9 DQRTITLEMNESQEVRALK----QKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKII 69

  Fly    75 HLVIKAPTRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDML 139
            .|:.|... :...|..:   |..||             .|.||.|            :|...|::
  Fly    70 VLMGKKKV-DKSSPEEK---VAPTP-------------PLAAGPN------------VLRTEDVV 105

  Fly   140 RSLMDNPM-VQQMM-----------------NNPD-TMRQLITSNPQ------------------ 167
            .||..|.. |..:|                 |:|: .:..||...||                  
  Fly   106 PSLAPNDQWVSDLMSMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSD 170

  Fly   168 -------------MHDLMQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSNLESVP 219
                         |.:::.:|||:.|.|.|  .|.:|     :|:..:...|:.:..|:   .:.
  Fly   171 QLQQLMADLNITRMREMINQNPELIHRLMN--RLAET-----DPATFEVFQRNQEELMN---MIS 225

  Fly   220 GGYSALQRIYRDIQEPMMNAATESFGR 246
            ||.|........:|..:....|.:.||
  Fly   226 GGASRTPNEIEHLQITLTAEETAAVGR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 19/68 (28%)
hPLIC_N 9..79 CDD:176403 19/68 (28%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
CG10694NP_651212.1 rad23 1..284 CDD:273167 60/287 (21%)
UBQ 1..76 CDD:294102 20/70 (29%)
UBA1_Rad23_like 110..148 CDD:270466 6/37 (16%)
XPC-binding 172..227 CDD:286376 12/64 (19%)
UBA2_Rad23_like 245..282 CDD:270467 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.