DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and nedd8

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_958478.2 Gene:nedd8 / 368667 ZFINID:ZDB-GENE-030616-588 Length:89 Species:Danio rerio


Alignment Length:90 Identity:23/90 - (25%)
Similarity:41/90 - (45%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....::..|..|.:|....|:|..||::||.|.|..|...:.|:....:
Zfish     3 IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIQGGSVL 67

  Fly    75 HLVIKAPTRNNEQPARQPADVRQTP 99
            |||:          |.:...:.|.|
Zfish    68 HLVL----------ALRGGQIHQKP 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 20/68 (29%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
nedd8NP_958478.2 Ubl_NEDD8 3..76 CDD:340504 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.