DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Rad23a

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_006255338.1 Gene:Rad23a / 361381 RGDID:1309899 Length:363 Species:Rattus norvegicus


Alignment Length:326 Identity:65/326 - (19%)
Similarity:112/326 - (34%) Gaps:112/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQ-------LVLIFAGKIMKDTDTLQM 65
            :.:.:||.:.:. .:.::.|..:|..|    :|.|||..:       ..||:||||:.|...::.
  Rat     3 VTITLKTLQQQTFKIRMEPDETVKVLK----EKIEAEKGRDAFPVAGQKLIYAGKILSDDIPIKE 63

  Fly    66 HNIKD-NLTVHLVIKA------PTRNNEQPARQPADVRQTPF----------------------- 100
            ::|.: |..|.:|.||      |......|...|..  .|||                       
  Rat    64 YHIDEKNFVVVMVTKAKAGQGTPAPPEASPTAAPEP--STPFPPAPASGMSHPPPSNREDKSSSE 126

  Fly   101 ------------GLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNG-------DMLRSLMDNP 146
                        |.....|.:|.|...|.:.........|..|:::.|       ..||:..:||
  Rat   127 ESATTTSPESISGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNP 191

  Fly   147 --------------------MVQQMM-----------NNPDTMRQLITSNPQ---MHDLMQRNPE 177
                                .||:..           .||   .:.:...||   |..::|:||.
  Rat   192 HRAVEYLLTGIPGSPEPEHGSVQESQAPEQPATEAAGENP---LEFLRDQPQFQNMRQVIQQNPA 253

  Fly   178 ISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSNLESVPGGYSALQRIYRDI-----QEPMM 237
            :.     |.||:|..:  .||.:||::.|..::.:..|...||..:.:..:..::     :.|.|
  Rat   254 LL-----PALLQQLGQ--ENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGALGEEAPQM 311

  Fly   238 N 238
            |
  Rat   312 N 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 20/78 (26%)
hPLIC_N 9..79 CDD:176403 20/78 (26%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
Rad23aXP_006255338.1 rad23 3..361 CDD:273167 65/326 (20%)
RAD23_N 3..80 CDD:176400 21/80 (26%)
UBA1_Rad23 162..201 CDD:270560 7/38 (18%)
XPC-binding 232..287 CDD:286376 16/61 (26%)
UBA2_HR23A 319..359 CDD:270610
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.