DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Nedd8

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001286070.1 Gene:Nedd8 / 35151 FlyBaseID:FBgn0032725 Length:84 Species:Drosophila melanogaster


Alignment Length:69 Identity:20/69 - (28%)
Similarity:35/69 - (50%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....:...|..|.:|....|:|..|||:||.|.|..|...:.::....:
  Fly     3 IKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVL 67

  Fly    75 HLVI 78
            |||:
  Fly    68 HLVL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 20/69 (29%)
hPLIC_N 9..79 CDD:176403 20/69 (29%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
Nedd8NP_001286070.1 Ubl_NEDD8 3..76 CDD:340504 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.