DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and LOC3290537

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_550846.4 Gene:LOC3290537 / 3290537 VectorBaseID:AGAMI1_000134 Length:685 Species:Anopheles gambiae


Alignment Length:77 Identity:29/77 - (37%)
Similarity:44/77 - (57%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGSKRINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHN 67
            ||   :.:.|||...|. |:||:....|::.|..:..|....|:|..||||||.::|..||..:|
Mosquito    75 GG---MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

  Fly    68 IKDNLTVHLVIK 79
            |:...|:|||::
Mosquito   137 IQKESTLHLVLR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 27/72 (38%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
LOC3290537XP_550846.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.