DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Ubi-p5E

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:77 Identity:29/77 - (37%)
Similarity:44/77 - (57%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGSKRINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHN 67
            ||   :.:.|||...|. |:||:....|::.|..:..|....|:|..||||||.::|..||..:|
  Fly    75 GG---MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

  Fly    68 IKDNLTVHLVIK 79
            |:...|:|||::
  Fly   137 IQKESTLHLVLR 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 27/72 (38%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582