DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Ubl7

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_006243217.1 Gene:Ubl7 / 300744 RGDID:1303055 Length:404 Species:Rattus norvegicus


Alignment Length:523 Identity:106/523 - (20%)
Similarity:178/523 - (34%) Gaps:197/523 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IKDFKILVAQKFE---AEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLVIKAPTRNNEQPARQ 91
            |...|.|:|.|.:   .:||.:.||:.|:.:||..||..:.|:...|||::.|:....:::|  :
  Rat    63 ISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKP--E 125

  Fly    92 PADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMDNPMVQQMMNNPD 156
            |.|   ....|.:|                     |:.:..|::....|.     .|.:|:||.:
  Rat   126 PVD---KVAALREF---------------------RVLHTALHSSSSYRE-----AVFKMLNNKE 161

  Fly   157 TMRQLITSNPQMHDLMQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSN-----LE 216
            ::.|:|.:.|.    :..:|....:|.:.||    ..:..:|:||..|:.:|. |:.|     |.
  Rat   162 SLDQIIVATPG----LSSDPIALGVLQDKDL----FSVFADPNMLDTLVPAHP-ALVNAIILVLH 217

  Fly   217 SVPGGYSALQRIYRDIQEPMMNAATESFGRNPFAGLVDGGGSGAGNNPQQGTENRNPLPNPWGGA 281
            ||.|.                                                  .|:|    ||
  Rat   218 SVAGS--------------------------------------------------TPMP----GA 228

  Fly   282 NSGTNGTVGGSGAGNPTGDLPPNNVLNTPAMRSLLQQMADNPAMMQNLLNAPYTRSMMESMSQDP 346
            :|.:......|....|.|.|                                     .:.:|.|.
  Rat   229 DSSSRSMPSSSYRDMPGGFL-------------------------------------FDGLSDDE 256

  Fly   347 D---MAARLLSSSPLMSNNPALQEQVRQMMPQFMAQMQNPEVMNMLTNPDAMNAILQIQQGMEQL 408
            |   .:.|...||...|:.||.........|:.:.|.:....:.:.:.|::.:            
  Rat   257 DDFHPSTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSS------------ 309

  Fly   409 RSAAPGLVGTLGIPPPPPGAGTGTNPASGDGSGGNSGASTNNVSPSSGLNAGTGTPNLAPGGGPN 473
            .:..||          ..|..:||:|.                  |||:.:||...|        
  Rat   310 HTPTPG----------TQGHSSGTSPM------------------SSGVQSGTPITN-------- 338

  Fly   474 AQLFNDFMMRMLNGMSNNADNTQPP-EVRYQSQLEQLNAMGFVNRDANLQALIATFGDINAAVER 537
             .||:..:...|     .|...||. :.::|.||:||..||..:.:.:|:||.||.|||.||:|.
  Rat   339 -DLFSQALQHAL-----QASGQQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALEL 397

  Fly   538 LLS 540
            :.:
  Rat   398 IFA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 18/51 (35%)
hPLIC_N 9..79 CDD:176403 18/51 (35%)
STI1 322..368 CDD:128966 9/48 (19%)
UBA_PLICs 501..537 CDD:270582 17/35 (49%)
Ubl7XP_006243217.1 BMSC_UbP_N 41..115 CDD:176410 18/51 (35%)
UBQ <62..113 CDD:214563 18/49 (37%)
UBA_UBL7 <370..399 CDD:270511 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.