DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ubqn and Ubd

DIOPT Version :9

Sequence 1:	NP_001285457.1	Gene:	Ubqn / 32977	FlyBaseID:	FBgn0031057	Length:	547	Species:	Drosophila melanogaster
Sequence 2:	NP_445751.2	Gene:	Ubd / 29168	RGDID:	69418	Length:	161	Species:	Rattus norvegicus

Alignment Length:	133	Identity:	25/133 - (18%)
Similarity:	50/133 - (37%)	Gaps:	20/133 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLVIKAPTRNN 85
            |.:......:|.....:..:.:...:..:|:...||:|....|..:.|....|:||.:|..
  Rat    17 TFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALSSYGIDKENTIHLTLKVV---- 77

  Fly    86 EQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMDNPMVQQ 150
                 :|:| .:.|..|.:.|. .|...|         |:.|..:.:....:|:.::...|..:|
  Rat    78 -----KPSD-EELPLSLVESGD-EGQRHL---------LRVRRSSSVAQVKEMIENVTAVPPKKQ 126

  Fly   151 MMN 153
            .:|
  Rat   127 FVN 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ubqn	NP_001285457.1	UBQ	9..79	CDD:214563	11/57 (19%)
		hPLIC_N	9..79	CDD:176403	11/57 (19%)
		STI1	322..368	CDD:128966
		UBA_PLICs	501..537	CDD:270582
Ubd	NP_445751.2	UBQ	8..75	CDD:214563	11/57 (19%)
		UBQ	17..75	CDD:294102	11/57 (19%)
		UBQ	92..154	CDD:214563	9/48 (19%)
		ubiquitin	95..154	CDD:278661	8/44 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900