DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and AT1G53950

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001319219.1 Gene:AT1G53950 / 28717351 AraportID:AT1G53950 Length:144 Species:Arabidopsis thaliana


Alignment Length:69 Identity:20/69 - (28%)
Similarity:36/69 - (52%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDK-KTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.:||...: .|.||.....|::.|....:|.....||..|||.|::::|:..:..:|||...|:
plant    71 IFIKTLTGRTNTYEVKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLEDSKAISDYNIKHESTL 135

  Fly    75 HLVI 78
            |:.:
plant   136 HITL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 20/69 (29%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
AT1G53950NP_001319219.1 Ubl1_cv_Nsp3_N-like 69..139 CDD:475130 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.