DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Ubl4a

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_663380.1 Gene:Ubl4a / 27643 MGIID:95049 Length:157 Species:Mus musculus


Alignment Length:235 Identity:45/235 - (19%)
Similarity:80/235 - (34%) Gaps:84/235 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNL 72
            :.:.||..:.:: :::|.||..:...|.||:.|......|..|:|.||.:.|...|..:||..|.
Mouse     1 MQLTVKALQGRECSLQVAEDELVSTLKHLVSDKLNVPVRQQRLLFKGKALADEKRLSDYNIGPNS 65

  Fly    73 TVHLVIKAPTRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGD 137
            .::||:|.                                               ::..||..|.
Mouse    66 KLNLVVKP-----------------------------------------------LEKVLLEEGS 83

  Fly   138 MLRSLMDNPMVQQMMNNPDTMRQLITSNPQMHDLMQRNPEISHMLNNPDLLRQTMELARNPSMLQ 202
            ..| |:|:|..        .:.|||:.                      :|.:...:|....:|:
Mouse    84 AHR-LVDSPAT--------PIWQLISK----------------------VLARHFSVADASRVLE 117

  Fly   203 ELMRSHDRAMSNLESVPGGYSALQRIYRDIQEPMMNAATE 242
            :|.|.:||::|.|.     ...::|:......|.:..|.|
Mouse   118 QLQRDYDRSLSRLT-----LDDIERLASRFLHPEVTEAME 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 21/70 (30%)
hPLIC_N 9..79 CDD:176403 21/70 (30%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
Ubl4aNP_663380.1 Ubl_UBL4A_like 1..72 CDD:340505 21/70 (30%)
Tugs 96..142 CDD:375372 13/72 (18%)
Required and sufficient for interaction with BAG6. /evidence=ECO:0000250|UniProtKB:P11441 96..138 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.