DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Ubqln3

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001371113.1 Gene:Ubqln3 / 244178 MGIID:3045291 Length:681 Species:Mus musculus


Alignment Length:97 Identity:19/97 - (19%)
Similarity:35/97 - (36%) Gaps:36/97 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KRIEYREQEKRCIVSYQDQAIVIVKESPENMMLNDVAVLL-------------------QSSNVQ 214
            |.::||..:|          :::.::..::...||||:|.                   |....|
Mouse    75 KEVQYRTVQK----------VILHEKYNQSEYDNDVALLYLHHPFYFTNYVQPVCILENQMHEKQ 129

  Fly   215 LDRFSLTIDKWG-------IGNEIEIAPIEKI 239
            |:.....|..||       :.|.::.|.:|.|
Mouse   130 LNFGLCYITGWGSSVLEGKLYNTLQEAEVELI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506
PABP-1234 <233..409 CDD:130689 3/7 (43%)
UBA_PLICs 501..537 CDD:270582
Ubqln3NP_001371113.1 Ubl_PLICs 43..115 CDD:340506 9/49 (18%)
STI1 212..256 CDD:128966
UBA_PLICs 641..678 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.