DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Oas1e

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001334379.1 Gene:Oas1e / 231699 MGIID:2180856 Length:386 Species:Mus musculus


Alignment Length:70 Identity:14/70 - (20%)
Similarity:32/70 - (45%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FMDLQARMQNELLNNGDMLRSLMDNPMVQQMMNNPDTMRQLITSNPQMHDLMQRNPEI---SHML 182
            |.|.:..:.:.|  :|.:.::   .|::   ::..|..|.:..|:.|..||:.:..:.   |:..
Mouse   282 FYDFRPEISDYL--HGQIKKA---RPLI---LDPADPTRNVAGSDLQAWDLLAKEAQTWIHSNFF 338

  Fly   183 NNPDL 187
            .|.|:
Mouse   339 RNCDM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563
hPLIC_N 9..79 CDD:176403
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
Oas1eNP_001334379.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.