DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Ubb

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001300913.1 Gene:Ubb / 22187 MGIID:98888 Length:305 Species:Mus musculus


Alignment Length:77 Identity:29/77 - (37%)
Similarity:44/77 - (57%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGSKRINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHN 67
            ||   :.:.|||...|. |:||:....|::.|..:..|....|:|..||||||.::|..||..:|
Mouse    75 GG---MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

  Fly    68 IKDNLTVHLVIK 79
            |:...|:|||::
Mouse   137 IQKESTLHLVLR 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 27/70 (39%)
hPLIC_N 9..79 CDD:176403 27/70 (39%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582