DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Oas1a

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_006249444.1 Gene:Oas1a / 192281 RGDID:621760 Length:367 Species:Rattus norvegicus


Alignment Length:119 Identity:20/119 - (16%)
Similarity:39/119 - (32%) Gaps:32/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 NPAMMQNLLNAPYTRSMME---------------SMSQDPDMAARLLSSSPLMSNNPALQEQVRQ 371
            ||..:...|:||:.:..:|               ..:.||.:...|:|....:...........:
  Rat   129 NPRALSFKLSAPHLQQEVEFDVLPAYDVLGHVSLYSNPDPKIYTILISECISLGKEGEFSTCFTE 193

  Fly   372 MMPQFMAQMQNPEVMNMLTNPDAMNAILQIQQGMEQLRSAAPGLVGTLGIPPPP 425
            :...|:.|           .|..:.:::::.:...||...      .||.|.||
  Rat   194 LQRNFLKQ-----------RPTKLKSLIRLVKHWYQLCKE------KLGKPLPP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563
hPLIC_N 9..79 CDD:176403
STI1 322..368 CDD:128966 10/60 (17%)
UBA_PLICs 501..537 CDD:270582
Oas1aXP_006249444.1 NT_2-5OAS_ClassI-CCAase 27..167 CDD:143390 6/37 (16%)
OAS1_C 164..348 CDD:287404 14/84 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.