DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and F14D2.11

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_494511.2 Gene:F14D2.11 / 184461 WormBaseID:WBGene00017459 Length:195 Species:Caenorhabditis elegans


Alignment Length:76 Identity:14/76 - (18%)
Similarity:30/76 - (39%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEGGSKRINVVVKTPKDKKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQM 65
            |......:....|:.....:|:.|:....::..|:.:.....:..    :.:.||.:.|..|...
 Worm   120 MKNSSMPKFQYFVRLNGKTRTLNVNASDTVEQGKMQLCHNARSTR----MSYGGKPLSDQITFGE 180

  Fly    66 HNIKDNLTVHL 76
            :||.:|.|:.|
 Worm   181 YNISNNSTMDL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 13/70 (19%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
F14D2.11NP_494511.2 Ubl1_cv_Nsp3_N-like 128..195 CDD:475130 13/68 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.