DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Nedd8

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_032709.1 Gene:Nedd8 / 18002 MGIID:97301 Length:81 Species:Mus musculus


Alignment Length:69 Identity:20/69 - (28%)
Similarity:35/69 - (50%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....::..|..|.:|....|:|..||::||.|.|..|...:.|.....:
Mouse     3 IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL 67

  Fly    75 HLVI 78
            |||:
Mouse    68 HLVL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 20/69 (29%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
Nedd8NP_032709.1 Ubl_NEDD8 3..76 CDD:340504 20/69 (29%)
Interaction with UBE1C. /evidence=ECO:0000250|UniProtKB:Q15843 70..72 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.