DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and C16C8.11

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_494548.1 Gene:C16C8.11 / 173690 WormBaseID:WBGene00015849 Length:214 Species:Caenorhabditis elegans


Alignment Length:104 Identity:24/104 - (23%)
Similarity:43/104 - (41%) Gaps:12/104 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 MADNPAMMQNLLNAPYTRSMMES-MSQDPDMAARLLSSSPLMSNNPALQEQVRQMMPQFMAQMQN 382
            |||:..:|..........|.::| :::|      .||||..:|.|..||............|...
 Worm     1 MADSNDLMSEFQKLQQETSKIQSHLTKD------FLSSSAKLSENRVLQATQELCGKLTEKQKVQ 59

  Fly   383 PEVMNMLTNPDAMNAILQIQQGMEQLRSAAPGLVGTLGI 421
            .:.:|:|     ::|:.|||:...::.:....:...|.|
 Worm    60 DDTINLL-----LSALGQIQENQNKILNQFASMQSQLDI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563
hPLIC_N 9..79 CDD:176403
STI1 322..368 CDD:128966 12/46 (26%)
UBA_PLICs 501..537 CDD:270582
C16C8.11NP_494548.1 COG5391 <9..>111 CDD:227680 20/96 (21%)
UBQ 149..212 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.