DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and UBL4B

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_981957.1 Gene:UBL4B / 164153 HGNCID:32309 Length:174 Species:Homo sapiens


Alignment Length:76 Identity:18/76 - (23%)
Similarity:39/76 - (51%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLVI----KAP 81
            :::|.....:...|.||:::.:...||..|:|.|::::|...|..:.|..|.::::::    |..
Human    14 SLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMA 78

  Fly    82 TRNNEQPARQP 92
            .:...||..||
Human    79 LKEAHQPQTQP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 13/61 (21%)
hPLIC_N 9..79 CDD:176403 13/61 (21%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
UBL4BNP_981957.1 UBQ 1..74 CDD:320785 13/59 (22%)
FlhF 20..>154 CDD:332151 17/70 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.