DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and LOC1281152

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_321091.4 Gene:LOC1281152 / 1281152 VectorBaseID:AGAMI1_000229 Length:236 Species:Anopheles gambiae


Alignment Length:72 Identity:23/72 - (31%)
Similarity:39/72 - (54%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNL 72
            :.:.|||...|. |::|.....:.|.|..:.|:....|:|..:|||||.:.|...:..:||:...
Mosquito     1 MQIFVKTLTGKTITLDVIASETVLDIKSKIEQREGIAPDQQRIIFAGKQLDDCRIISDYNIQHGS 65

  Fly    73 TVHLVIK 79
            |:|||::
Mosquito    66 TMHLVLR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 23/70 (33%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
LOC1281152XP_321091.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.