DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and Nedd8

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_317573.3 Gene:Nedd8 / 1278045 VectorBaseID:AGAMI1_013556 Length:79 Species:Anopheles gambiae


Alignment Length:69 Identity:21/69 - (30%)
Similarity:36/69 - (52%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....:...|..|.:|....|:|..|||:||.|.|..|.|.:.::....:
Mosquito     3 IKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAQDYKVQGGSVL 67

  Fly    75 HLVI 78
            |||:
Mosquito    68 HLVL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506 21/69 (30%)
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
Nedd8XP_317573.3 Ubl_NEDD8 3..76 CDD:340504 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.