DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and LOC1273370

DIOPT Version :10

Sequence 1:NP_608344.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_061508771.1 Gene:LOC1273370 / 1273370 VectorBaseID:AGAMI1_014146 Length:989 Species:Anopheles gambiae


Alignment Length:139 Identity:27/139 - (19%)
Similarity:55/139 - (39%) Gaps:38/139 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RVRMFFGLTTPPNALWSDVPIKILATISDYLKTKDRMNHRKVSRSLQDFVDYQGSGINSLEISYR 158
            ::::.:|..|..:..:|:        .|:::.|.|..:.:.::..::.::......:.|:.|.:|
Mosquito   190 KLQLTYGKMTLDDLFFSN--------CSEFIVTCDSFSIKDLNILVRQWIRGAIPSLKSITIRFR 246

  Fly   159 ---QNKV--CLTIDNKRIEYREQE-----KRCIVSYQDQAIVIVKESPENMMLNDVAVLLQSSNV 213
               :|:.  |...  |.|||..:|     ||..:...|..|              ..|||.|:. 
Mosquito   247 NITENRFDECALF--KEIEYTRKEEVQSVKRFTIERHDGTI--------------ANVLLYSTT- 294

  Fly   214 QLDRFSLTI 222
               ||..|:
Mosquito   295 ---RFYFTL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_608344.1 Ubl_PLICs 7..79 CDD:340506
PABP-1234 <233..409 CDD:130689
UBA_PLICs 501..537 CDD:270582
LOC1273370XP_061508771.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.