DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and NEDD8-MDP1

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001186752.1 Gene:NEDD8-MDP1 / 100528064 HGNCID:39551 Length:193 Species:Homo sapiens


Alignment Length:205 Identity:40/205 - (19%)
Similarity:74/205 - (36%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
            :.|||...|: .::::....::..|..|.:|....|:|..||::||.:..|       ::|    
Human     3 IKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQIDGT-------VRD---- 56

  Fly    75 HLVIKAPTRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDML 139
                           |:..|||..|........|..:...||.::...:::.  .|:||...|:.
Human    57 ---------------RRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG--ANQLLELFDLF 104

  Fly   140 RSLMDNPM-----------VQQMMNNP--------DTMRQLITSNPQMHDLMQRNPEISHMLNNP 185
            |..:...:           :||....|        |..|.::       |:.:......|:.|..
Human   105 RYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIV-------DVSKLGVTCIHIQNGM 162

  Fly   186 DL--LRQTME 193
            :|  |.|.:|
Human   163 NLQTLSQGLE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 15/68 (22%)
hPLIC_N 9..79 CDD:176403 15/68 (22%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
NEDD8-MDP1NP_001186752.1 UBQ 1..>51 CDD:294102 13/47 (28%)
UBQ 1..>50 CDD:214563 13/46 (28%)
Acid_PPase 51..177 CDD:289459 27/157 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.