Sequence 1: | NP_001285457.1 | Gene: | Ubqn / 32977 | FlyBaseID: | FBgn0031057 | Length: | 547 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186752.1 | Gene: | NEDD8-MDP1 / 100528064 | HGNCID: | 39551 | Length: | 193 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 40/205 - (19%) |
---|---|---|---|
Similarity: | 74/205 - (36%) | Gaps: | 57/205 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTV 74
Fly 75 HLVIKAPTRNNEQPARQPADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDML 139
Fly 140 RSLMDNPM-----------VQQMMNNP--------DTMRQLITSNPQMHDLMQRNPEISHMLNNP 185
Fly 186 DL--LRQTME 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ubqn | NP_001285457.1 | UBQ | 9..79 | CDD:214563 | 15/68 (22%) |
hPLIC_N | 9..79 | CDD:176403 | 15/68 (22%) | ||
STI1 | 322..368 | CDD:128966 | |||
UBA_PLICs | 501..537 | CDD:270582 | |||
NEDD8-MDP1 | NP_001186752.1 | UBQ | 1..>51 | CDD:294102 | 13/47 (28%) |
UBQ | 1..>50 | CDD:214563 | 13/46 (28%) | ||
Acid_PPase | 51..177 | CDD:289459 | 27/157 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |