DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubqn and zfand4

DIOPT Version :9

Sequence 1:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001189400.1 Gene:zfand4 / 100148477 ZFINID:ZDB-GENE-090312-102 Length:673 Species:Danio rerio


Alignment Length:329 Identity:69/329 - (20%)
Similarity:101/329 - (30%) Gaps:110/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VAQKFEAEPEQLVLIFAG-KIMKD-----TDTLQMHNIKDNLTV---HLVIKAPTRNNEQPARQP 92
            |.:|....|:...|...| |:|:|     ...|....::|.:.:   ||.:...|...|.|    
Zfish   324 VPRKIRLPPKVSRLDMRGPKVMRDCVYPPLSLLSSPGVQDEVDIKNEHLTLTEKTTVIESP---- 384

  Fly    93 ADVRQTPFGLNQFGGLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMDNPMVQQMMNNPDT 157
               :..||.|        .|.|.      :|:.|:.:.. ||:..|..:....|::.|.:|    
Zfish   385 ---KAVPFNL--------PEPLS------LDVSAQRERS-LNSLTMPEANAAAPLLSQAVN---- 427

  Fly   158 MRQLITSN---PQMHDL-----------------MQRNPEISHMLNNPDLLRQTMEL-ARNPSML 201
                  ||   |..|||                 ...:|..||.     |||.:..| ..:||..
Zfish   428 ------SNWRLPSQHDLTLTTEPFTPPRHFEFTGSSVHPSPSHA-----LLRTSPSLPISSPSKT 481

  Fly   202 QELMRSHDRAMSNLESVPGGYSALQRIYRDIQEPMMNAATESFG----RNPFAGLVDGGGSGAGN 262
            ...:..|...:|..|:            |||......|..|..|    ....|.|...||.....
Zfish   482 TFKVDKHSEVISKSEA------------RDITNLANKATKEPLGSVSNAELLASLAGSGGQETLT 534

  Fly   263 NPQ---QGTENRNPLPN----------------------PWGGANSGTNGTVGGSGAGNPTGDLP 302
            :|.   :......||||                      ....::||.:.::  ...|..|..||
Zfish   535 SPYALGRLCATAAPLPNNIHLLQEDLLRRISPLQRTAGFTASSSSSGLSSSI--KRLGTQTHHLP 597

  Fly   303 PNNV 306
            |..|
Zfish   598 PVKV 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 12/50 (24%)
hPLIC_N 9..79 CDD:176403 12/50 (24%)
STI1 322..368 CDD:128966
UBA_PLICs 501..537 CDD:270582
zfand4NP_001189400.1 AN1_N 1..103 CDD:176397
UBQ 28..99 CDD:214563
ZnF_AN1 613..651 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.