DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dome and et

DIOPT Version :9

Sequence 1:NP_523412.1 Gene:dome / 32976 FlyBaseID:FBgn0043903 Length:1282 Species:Drosophila melanogaster
Sequence 2:NP_001245761.1 Gene:et / 32975 FlyBaseID:FBgn0031055 Length:645 Species:Drosophila melanogaster


Alignment Length:506 Identity:125/506 - (24%)
Similarity:200/506 - (39%) Gaps:85/506 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NTTILFSDTN-AVEQENDYHCMCDEYVINKSKVYVGTRPLL-VRDFNCLDYDFQFMVCNFTQPPN 149
            |.|::..|.| |.|.|..|.|:.|..:  :|.|.|....|| ::||.|.|..: ::.|.|::..|
  Fly    81 NGTVVHVDANPANEWERRYECLLDGVI--QSHVCVRVYALLNLKDFVCRDVVY-YLRCTFSRMEN 142

  Fly   150 TVITKYNISYNTNNDWRY------SNTLDCNFD----SAPVVTCNLTDDNYKRFSETFYFRLSIS 204
            .         |..|...|      :..:||...    |...|.|::..|...|..|...|||.:|
  Fly   143 G---------NFENKTHYQLAMGRAKPIDCRKSEDERSRGKVECSVPIDPNSRAPEWRDFRLIMS 198

  Fly   205 NALGHETQPITINHFERLVPARPGQNLTLLNRTESSVCLSWEMP--------------RRS---N 252
            :.||::::.:.:...|..|...|.....:: :|.:..||.|..|              |.|   |
  Fly   199 DDLGNQSKVLRLTQAEMEVLEWPRGKHNMI-QTPNQTCLEWNGPFIYPNRTFELNVQFRHSKLPN 262

  Fly   253 YNRGL-VWQVRVTPQNFEPITRPSWRNHTLTIKDTLCLTELPFAGYNYTLRVRVRANQNNTLWSE 316
            .:|.| |.|:|                 .:::.|.:|....|..  |....|.:....:.:.|||
  Fly   263 LSRNLTVSQMR-----------------AVSVFDQVCFGNPPEG--NQLFYVSLSRRLHGSPWSE 308

  Fly   317 --PMIYAFATAPAPPRRPPRVTYGSFYVYSSEKAMRFYWEPLEEHELNGPDFRYSISEYRINGTA 379
              |. :...|..:.|.||||.....|....:::.::.||.||:|.|.||.:..|..|.......|
  Fly   309 RYPE-FELTTNASLPARPPRFLANGFSHDRAKRELKVYWLPLDELEFNGAEQTYVASTRYGTKVA 372

  Fly   380 VDPGLIKVESNSAMIDHWSMSAVHHFLIRSSNSQGLSVNATPMTIGPISNRDFKVREPRNIRSVY 444
            ...|     |..|:...|..:......:.|||..|.|:.::.:.:..:|:    :|:.|.....|
  Fly   373 TTQG-----SMLAIFTDWDDTQPATVSVWSSNVVGRSLESSQLEVPRLSD----IRDRRIYLESY 428

  Fly   445 HPTNKSYTLSWDPPSDQRELQNYTVFWCVPKPGLQSECE--GSIRFAEVASGLHHFTTSPDQLLT 507
            :.|  |..|||..|.:......|.|:||.....:...|:  .||.........::|:....   .
  Fly   429 NKT--SSRLSWQGPEELGNFTGYIVYWCKLSSKVHDACDDSSSIETTYARETAYNFSGIQG---V 488

  Fly   508 LHMAVSANYQSH-NTGLHWAICSS---DKKDDLAKMEPSIDVATSTSLTVS 554
            :.|||:|||... .||:.|....|   :|...|..:|.:|.:....||.::
  Fly   489 IRMAVAANYSDGLTTGMRWWSGDSEVPEKPKILRYVEGTIALLVLGSLVLA 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
domeNP_523412.1 fn3 541..621 CDD:278470 3/14 (21%)
FN3 633..732 CDD:238020
etNP_001245761.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016893
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.