DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment et and dome

DIOPT Version :9

Sequence 1:NP_001245761.1 Gene:et / 32975 FlyBaseID:FBgn0031055 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_523412.1 Gene:dome / 32976 FlyBaseID:FBgn0043903 Length:1282 Species:Drosophila melanogaster


Alignment Length:506 Identity:125/506 - (24%)
Similarity:200/506 - (39%) Gaps:85/506 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NGTVVHVDANPANEWERRYECLLDGVI--QSHVCVRVYALLNLKDFVCRDVVY-YLRCTFSRMEN 142
            |.|::..|.| |.|.|..|.|:.|..:  :|.|.|....|| ::||.|.|..: ::.|.|::..|
  Fly    87 NTTILFSDTN-AVEQENDYHCMCDEYVINKSKVYVGTRPLL-VRDFNCLDYDFQFMVCNFTQPPN 149

  Fly   143 G---------NFENKTHYQLAMGRAKPIDCRKSEDERSRGKVECSVPIDPNSRAPEWRDFRLIMS 198
            .         |..|...|      :..:||...    |...|.|::..|...|..|...|||.:|
  Fly   150 TVITKYNISYNTNNDWRY------SNTLDCNFD----SAPVVTCNLTDDNYKRFSETFYFRLSIS 204

  Fly   199 DDLGNQSKVLRLTQAEMEVLEWPRGKHNMI-QTPNQTCLEWNGPFIYPNRTFELNVQFRHSKLPN 262
            :.||::::.:.:...|..|...|.....:: :|.:..||.|..|              |.|   |
  Fly   205 NALGHETQPITINHFERLVPARPGQNLTLLNRTESSVCLSWEMP--------------RRS---N 252

  Fly   263 LSRNLTVSQMR-----------------AVSVFDQVCFGNPPEG--NQLFYVSLSRRLHGSPWSE 308
            .:|.| |.|:|                 .:::.|.:|....|..  |....|.:....:.:.|||
  Fly   253 YNRGL-VWQVRVTPQNFEPITRPSWRNHTLTIKDTLCLTELPFAGYNYTLRVRVRANQNNTLWSE 316

  Fly   309 RYPE-FELTTNASLPARPPRFLANGFSHDRAKRELKVYWLPLDELEFNGAEQTYVASTRYGTKVA 372
              |. :...|..:.|.||||.....|....:::.::.||.||:|.|.||.:..|..|.......|
  Fly   317 --PMIYAFATAPAPPRRPPRVTYGSFYVYSSEKAMRFYWEPLEEHELNGPDFRYSISEYRINGTA 379

  Fly   373 TTQG-----SMLAIFTDWDDTQPATVSVWSSNVVGRSLESSQLEVPRLSD----IRDRRIYLESY 428
            ...|     |..|:...|..:......:.|||..|.|:.::.:.:..:|:    :|:.|.....|
  Fly   380 VDPGLIKVESNSAMIDHWSMSAVHHFLIRSSNSQGLSVNATPMTIGPISNRDFKVREPRNIRSVY 444

  Fly   429 NKT--SSRLSWQGPEELGNFTGYIVYWCKLSSKVHDACDDSSSIETTYARETAYNFSGIQG---V 488
            :.|  |..|||..|.:......|.|:||.....:...|:  .||.........::|:....   .
  Fly   445 HPTNKSYTLSWDPPSDQRELQNYTVFWCVPKPGLQSECE--GSIRFAEVASGLHHFTTSPDQLLT 507

  Fly   489 IRMAVAANYSDGLTTGMRWWSGDSEVPEKPKILRYVEGTIALLVLGSLVLA 539
            :.|||:|||... .||:.|....|   :|...|..:|.:|.:....||.::
  Fly   508 LHMAVSANYQSH-NTGLHWAICSS---DKKDDLAKMEPSIDVATSTSLTVS 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etNP_001245761.1 None
domeNP_523412.1 fn3 541..621 CDD:278470 3/14 (21%)
FN3 633..732 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016893
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.