DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssu72 and AT1G73820

DIOPT Version :9

Sequence 1:NP_001285455.1 Gene:Ssu72 / 32973 FlyBaseID:FBgn0031054 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001320369.1 Gene:AT1G73820 / 843718 AraportID:AT1G73820 Length:209 Species:Arabidopsis thaliana


Alignment Length:196 Identity:77/196 - (39%)
Similarity:127/196 - (64%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TDPSKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIY 66
            |.|.:...|:|||||.|||||||..|.::|.:|.|||||..|||||.:..:||||:|||.|:.::
plant    14 TPPMRFRYAMVCSSNQNRSMEAHALLKRQGLDVASYGTGSHVKLPGPSLREPNVYDFGTPYKQMF 78

  Fly    67 RDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQ--FDIIVTVEERVYDLVVMHMESMES 129
            .:|..||.|.|.:||:|.|:.||..:|..|:|:||....  ||:::|.||:|:|.|:..:.:.|.
plant    79 DELRRKDPELYKRNGILQMIKRNLSVKLAPQRWQDNAGDGVFDVVMTFEEKVFDSVLEDLNNREQ 143

  Fly   130 VDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLF 194
            ...:.:.|:|::|.||.|:|.:|..:..::...:..:...::.||:::..||::.:|.:::|:.|
plant   144 SLTKTILVMNLEVKDNHEEAAIGGRLALELCQEIEGNETWEDTIDDIVAGFEKQHRRKLVYSISF 208

  Fly   195 Y 195
            |
plant   209 Y 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssu72NP_001285455.1 Ssu72 7..195 CDD:282565 73/189 (39%)
AT1G73820NP_001320369.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 161 1.000 Domainoid score I1263
eggNOG 1 0.900 - - E1_COG5211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6754
Inparanoid 1 1.050 165 1.000 Inparanoid score I1594
OMA 1 1.010 - - QHG54555
OrthoDB 1 1.010 - - D1304061at2759
OrthoFinder 1 1.000 - - FOG0002112
OrthoInspector 1 1.000 - - oto3314
orthoMCL 1 0.900 - - OOG6_103165
Panther 1 1.100 - - LDO PTHR20383
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1400
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.