DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssu72 and SSU72

DIOPT Version :9

Sequence 1:NP_001285455.1 Gene:Ssu72 / 32973 FlyBaseID:FBgn0031054 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_054907.1 Gene:SSU72 / 29101 HGNCID:25016 Length:194 Species:Homo sapiens


Alignment Length:191 Identity:117/191 - (61%)
Similarity:147/191 - (76%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDL 69
            |.|.||||||||.||||||||.|:|:||:|||:|||..|||||.|.||||||:|.|.|:.:|.||
Human     4 SPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDL 68

  Fly    70 ESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRP 134
            ..||||.|||||:|||||||:|||..|||||:.|:.||:|:|.||||||.||..:.|.|....:|
Human    69 LRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQP 133

  Fly   135 VHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY 195
            |||:|||:.||.|:|.:|||:|.::...:..:.|::|:||||:|||||:..|..||:|.||
Human   134 VHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssu72NP_001285455.1 Ssu72 7..195 CDD:282565 114/187 (61%)
SSU72NP_054907.1 Ssu72 6..194 CDD:398413 114/187 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159024
Domainoid 1 1.000 240 1.000 Domainoid score I2256
eggNOG 1 0.900 - - E1_COG5211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6754
Inparanoid 1 1.050 242 1.000 Inparanoid score I3328
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54555
OrthoDB 1 1.010 - - D1304061at2759
OrthoFinder 1 1.000 - - FOG0002112
OrthoInspector 1 1.000 - - otm41443
orthoMCL 1 0.900 - - OOG6_103165
Panther 1 1.100 - - LDO PTHR20383
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1403
SonicParanoid 1 1.000 - - X1400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.