DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14223 and SERF1B

DIOPT Version :9

Sequence 1:NP_001259723.1 Gene:CG14223 / 32972 FlyBaseID:FBgn0031053 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_075267.1 Gene:SERF1B / 728492 HGNCID:10756 Length:110 Species:Homo sapiens


Alignment Length:47 Identity:16/47 - (34%)
Similarity:21/47 - (44%) Gaps:7/47 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 SVISAG-QLPATLPVSMPLPPGPFHTYQAAHQGHQSHLVPPSVTAVS 494
            |.:||| .||...|...|..|.|      |..|.:.:|...|:|.:|
Human    47 SKMSAGPHLPLKAPRENPCFPLP------AAGGSRYYLAYGSITPIS 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14223NP_001259723.1 Jiraiya 301..441 CDD:291697
SERF1BNP_075267.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61 6/13 (46%)
4F5 1..37 CDD:309527
Required for SNCA binding. /evidence=ECO:0000269|PubMed:31034892 11..17
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.