DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14223 and SERF2

DIOPT Version :9

Sequence 1:NP_001259723.1 Gene:CG14223 / 32972 FlyBaseID:FBgn0031053 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001186804.1 Gene:SERF2 / 10169 HGNCID:10757 Length:170 Species:Homo sapiens


Alignment Length:162 Identity:36/162 - (22%)
Similarity:53/162 - (32%) Gaps:42/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 REKTISYRGAPLSHNLSVISAGQLPATLPVSMPLPPGPFHTYQAAHQGHQS----HLVPPSVTAV 493
            ::::.|.:|......||..:..|.......:..|.|..||....|.....|    .|||||..:.
Human    16 KKQSDSVKGKRRDDGLSAAARKQRVGVQQPNAELSPIHFHLILCALHPPASCPFCPLVPPSAPSS 80

  Fly   494 SPNHSHGSF------------NPLLLGGGGGGGGALGAVNSSFLVRPATATP----PTPTPRTLA 542
            .|..:..|.            ||                 |||:....|..|    |..:|.|||
Human    81 LPPGTRRSCSRSRKRQTRRRRNP-----------------SSFVASCPTLLPFACVPGASPTTLA 128

  Fly   543 NSSCLTAGREASGSVSPGIPPTLDMSNITVLL 574
            ....:     .:|..:.|||..|.:..:..:|
Human   129 FPPVV-----LTGPSTDGIPFALSLQRVPFVL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14223NP_001259723.1 Jiraiya 301..441 CDD:291697 1/7 (14%)
SERF2NP_001186804.1 4F5 1..37 CDD:309527 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.