DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACTR8

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_075050.3 Gene:ACTR8 / 93973 HGNCID:14672 Length:624 Species:Homo sapiens


Alignment Length:390 Identity:76/390 - (19%)
Similarity:136/390 - (34%) Gaps:123/390 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KHLLVSPKERKF----VLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALV 135
            |:|.:..|:.|:    :|:.:::....::| |..::.:....|.::.....:.|.....:.:..:
Human   218 KYLEIPLKDLKYYRCILLIPDIYNKQHVKE-LVNMILMKMGFSGIVVHQESVCATYGSGLSSTCI 281

  Fly   136 VDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAI--------------HAE----------IKRQL 176
            ||||..:|||..|..||.........:||||.:              :.|          :.:.|
Human   282 VDVGDQKTSVCCVEDGVSHRNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHL 346

  Fly   177 VE---------SGVKE-----------SLLTESVLEDIKVRTCF--------------VTTMER- 206
            .|         ||:::           :||.:..|.|.|::...              :||::. 
Human   347 KETFCHLDQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHR 411

  Fly   207 ------------------------AKARAN-----------GD-ENQPTPAPD------------ 223
                                    |||.|:           || ..|.:..|:            
Human   412 SQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSA 476

  Fly   224 -VDYIVSDNDAVIQVPGLLRESAYEIMFEASNERDSLPHLILRSILDC--TLDVRRALVESVFLV 285
             .|.:::.||:...:..|:.......:||  .:...|...||.|| ||  :.|.::.:..|:.:|
Human   477 QGDGLMAGNDSEEALTALMSRKTAISLFE--GKALGLDKAILHSI-DCCSSDDTKKKMYSSILVV 538

  Fly   286 GGGSMVQGLLARLRQELQH-LLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQ 349
            |||.|..    :.::.||| :|.:.|....|....:..............||.|||:....|..|
Human   539 GGGLMFH----KAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQ 599

  Fly   350  349
            Human   600  599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 72/379 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 76/390 (19%)
ACTR8NP_075050.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
NBD_sugar-kinase_HSP70_actin 162..619 CDD:388382 76/390 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..462 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.