DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACTL6A

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:429 Identity:80/429 - (18%)
Similarity:150/429 - (34%) Gaps:110/429 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMT---------------------------TTGIRKR 51
            :|.|||:...:.|:|.|..|:...||.:.|.                           |..:|..
Human    14 LVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVP 78

  Fly    52 LFDYDTPEELYDQLV---DFLQTI----FFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVH 109
            ..:.:....|.:.:|   |..|.|    :..|:.........::.|..:.:...||.|..::|.|
Human    79 RENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEH 143

  Fly   110 FDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKR 174
            :::.:.......::........|.|::|.|.:.|:.:||..|..:..........|..|..:.:.
Human   144 YNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRE 208

  Fly   175 QLVESGV------------------------KESL--LTES--------VLEDIKVRTCFVTTME 205
            ...|..:                        ||.|  :|.|        |::|.:.....|:.  
Human   209 LFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSD-- 271

  Fly   206 RAKARANGDENQPTPAPDVDYIVSDNDAVIQVP-------GLLRESAYEIMFEASNERD------ 257
                 :..||......|.|.|         :.|       |..|....|.:|:.||.:.      
Human   272 -----STYDEQVAAQMPTVHY---------EFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTM 322

  Fly   258 -SLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQ 321
             .:.|::..|:..|.:|:|..|..||.:.||.:::|....||.:||          :::....::
Human   323 LGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNREL----------SQKTPPSMR 377

  Fly   322 FKFF--NAVGKQNFTAWLGGALCGATDLIQTRSLVKETY 358
            .|..  |...::.|::|:||::..:....|...:.|:.|
Human   378 LKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 76/409 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 80/429 (19%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 80/429 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.