DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ARP4

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_012454.1 Gene:ARP4 / 853364 SGDID:S000003617 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:464 Identity:87/464 - (18%)
Similarity:153/464 - (32%) Gaps:150/464 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTT-------------GIRKR---------- 51
            |...:|:|.|:..|.:|::...:|:.|:|:.....|.             ||.::          
Yeast    13 EVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELKPIIEN 77

  Fly    52 --LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSS 114
              :.|:||.:|.:...   ||...:   |.|......:|.|.|:.||..|:....||.......:
Yeast    78 GLVIDWDTAQEQWQWA---LQNELY---LNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEA 136

  Fly   115 VLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQL--- 176
            ....|...........|..||||:|:...||.|:..|:.:..:.:.....|..|:..||:.|   
Yeast   137 CYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPK 201

  Fly   177 -----------------------VESGVKESLLTESVLEDIKVRTCFV---TTMERAKARANGDE 215
                                   |:..:.:........::.|...|.:   .|:|..|...:...
Yeast   202 EIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTA 266

  Fly   216 NQPTPAPDVDYIVSDNDAVI------------QVP--------GLLR------------------ 242
            .:...:|..:.||.||:...            .:|        |:::                  
Yeast   267 KRSIESPWNEEIVFDNETRYGFAEELFLPKEDDIPANWPRSNSGVVKTWRNDYVPLKRTKPSGVN 331

  Fly   243 --------------ESAYEIMFEASNERDS-----------------------LPHLILRSILDC 270
                          |:..:....|:|..|:                       |..|:..||:..
Yeast   332 KSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEEKPPKENNELIGLADLVYSSIMSS 396

  Fly   271 TLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFF---NAVGKQN 332
            .:|:|..|..:|.|.||.|.:.||..||..||..:|.           .|:|:..   :.:.:| 
Yeast   397 DVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILP-----------SLKFRILTTGHTIERQ- 449

  Fly   333 FTAWLGGAL 341
            :.:||||::
Yeast   450 YQSWLGGSI 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 85/460 (18%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 86/462 (19%)
ARP4NP_012454.1 COG5277 9..488 CDD:227602 87/464 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.