DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ARP2

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_010255.1 Gene:ARP2 / 851532 SGDID:S000002187 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:93/393 - (23%)
Similarity:152/393 - (38%) Gaps:93/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV------------VMT---------------- 44
            |....|||||.||.:.|:|.|.|.:|....|:.|            |.|                
Yeast     1 MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

  Fly    45 --------TTGIRKRLFDYDTPEELYDQLVDFLQTIFFKHL-LVSPKERKFVLVENVFGSTVLRE 100
                    ..||.|...|.   |.|:|.       .||:.: |.|....|.:|.|........||
Yeast    66 YLQISYPMENGIIKNWTDM---ELLWDY-------AFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

  Fly   101 TLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGG 165
            .:..|:|..:|...|......::||....:.:.:|||.|...|.::||:..|.:....:.....|
Yeast   121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAG 185

  Fly   166 SAIHAEIKRQLVESGVKESLLTE-----------SVLEDIKVRTCFVT---TMERAKARANGDEN 216
                .::.|.|::      ||:.           ..:..||.:.|:|:   .::...||      
Yeast   186 ----RDVTRHLID------LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR------ 234

  Fly   217 QPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMFE---ASNERDSLPHLILRSILDCTLDVRRAL 278
             .|.|....|.:.|. ..|:| |..|..|.|.:|:   ...|:..:..|:..::....:|:|.:|
Yeast   235 -ETTALVESYELPDG-RTIKV-GQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296

  Fly   279 VESVFLVGGGSMVQGLLARLRQELQHL-----LTEDPFYAERFHGELQFKFFNAVGKQNFTAWLG 338
            .:::.|.||.||..||.:||.:||:.|     |..||...::|...::     ...::....::|
Yeast   297 YKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIE-----DPPRRKHMVFIG 356

  Fly   339 GAL 341
            ||:
Yeast   357 GAV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 90/387 (23%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 92/389 (24%)
ARP2NP_010255.1 ACTIN 4..387 CDD:214592 92/390 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.