DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACT8

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_175350.1 Gene:ACT8 / 841347 AraportID:AT1G49240 Length:377 Species:Arabidopsis thaliana


Alignment Length:388 Identity:83/388 - (21%)
Similarity:157/388 - (40%) Gaps:74/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIRKR------------------- 51
            |||.|.||...|.|||.:..||.:.|:.|       ||  .|:.::                   
plant     9 PIVCDNGTGMVKAGFAGDDAPRAVFPSVVGRPRHHGVM--VGMNQKDAYVGDEAQSKRGILTLKY 71

  Fly    52 ------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHF 110
                  :.::|..|:::..       .|:..|.::|:|...:|.|........||.:.:::|..|
plant    72 PIEHGVVSNWDDMEKIWHH-------TFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETF 129

  Fly   111 DVSSVLFVPVH-LIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKR 174
            : |..::|.:. :::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.:
plant   130 N-SPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMK 193

  Fly   175 QLVESGVKESLLTE-SVLEDIKVRTCFVTT-----MERAKARANGDENQPTPAPDVDYIVSDNDA 233
            .|.|.|...:...| .::.|||.:..||..     ||.:|..::.::|...|           |.
plant   194 ILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELP-----------DG 247

  Fly   234 VIQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLL 295
            .:...|..|....|::|:.|   .|...:......||:.|.:|:|:.|..::.|.||.:|..|:.
plant   248 QVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIA 312

  Fly   296 ARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETY 358
            .|:.:|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|..|
plant   313 DRMSKEITALAP----------SSMKIKVV-APPERKYSVWIGGSILASLSTFQQMWISKAEY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 79/368 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 83/388 (21%)
ACT8NP_175350.1 NBD_sugar-kinase_HSP70_actin 5..377 CDD:418402 83/388 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.