DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ARP8

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_568836.2 Gene:ARP8 / 835717 AraportID:AT5G56180 Length:471 Species:Arabidopsis thaliana


Alignment Length:334 Identity:78/334 - (23%)
Similarity:136/334 - (40%) Gaps:66/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEE-LYDQ 64
            |.||....|....|::|.|:.|.|.|::..|.|            :|......::...|. :|.:
plant   123 MHIYSQRAQVPGSIIIDGGSGYCKFGWSKYASP------------SGRSATFLEFGNIESPIYAR 175

  Fly    65 LVDFLQTIFFKHLLVSPKERKFVL------VENVFGSTVLRETLARVLF-VHFD--VSSVLFVPV 120
            |..|..|||.: :.|.|..:..|:      .::...:...|..|...:| |.||  |.:|..|..
plant   176 LQQFFATIFTR-MQVKPSMQPIVVSLPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQ 239

  Fly   121 HLIALSTLAVPTALVVDVGYSETSVMPVFSG-VQIMAAFKDQSYGGSAIHAEIKRQLVESGVK-E 183
            .::||......:.:||::|:...:::|:..| |......:...:|...:...:|.::.|:.:. :
plant   240 AVLALYAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENNISFQ 304

  Fly   184 SLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDY---IVSDNDAVIQVPG-----L 240
            ||.|   :..:|.:.|:|.                     :||   :..|..|.::|.|     |
plant   305 SLYT---VRTLKEKLCYVA---------------------LDYKAELSKDTQASVEVSGEGWFTL 345

  Fly   241 LRE--SAYEIMFE---ASNERDSLPHLILRSILDCT---LDVRRALVESVFLVGGGSMVQGLLAR 297
            .:|  ...||:|:   |.....||...:...:..|.   |....:..::|.|.||.:.:.||..|
plant   346 SKERFQTGEILFQPRLAGMRAMSLHQAVSLCMDHCDAAGLTGDDSWFKTVVLTGGSACLPGLSER 410

  Fly   298 LRQELQ-HL 305
            |.:||| ||
plant   411 LERELQDHL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 74/324 (23%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 74/323 (23%)
ARP8NP_568836.2 F-box-like 43..83 CDD:289689
ACTIN 136..462 CDD:214592 74/321 (23%)
NBD_sugar-kinase_HSP70_actin <182..463 CDD:302596 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.