DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ARP7

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_567105.1 Gene:ARP7 / 825254 AraportID:AT3G60830 Length:363 Species:Arabidopsis thaliana


Alignment Length:392 Identity:82/392 - (20%)
Similarity:148/392 - (37%) Gaps:92/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFA-AEAYPRKIMPTEVVMTTTGIRKRLFD-----YDTPEELY---------- 62
            :|:|.|:.:.|.|.| .:..|..|:|:::        ||:.|     .|.|..::          
plant     4 LVVDAGSKFLKAGAAIPDQSPAMIIPSQM--------KRMVDDGSSSADNPTTVFEDVTLDPIER 60

  Fly    63 ------DQLVDFLQ---------------TIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVL 106
                  |.:.|.|:               .|.|...|.:||              .:||.|.:::
plant    61 GLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPK--------------AIREQLVQLM 111

  Fly   107 FVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAE 171
            |..|:||........:::|..:...:...||:|:.:..:.||..|.....|.|....||:.:...
plant   112 FETFNVSGFYASEQAVLSLYAVGRISGCTVDIGHGKIDIAPVLEGAVQHIASKRFELGGTELTKL 176

  Fly   172 IKRQLVESGVKESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQ 236
            ..::|.::....: |:.|.:|.:|.:.......|.|..:....|.:....||        ..||.
plant   177 FAQELGKTNPSMN-LSMSDVEKLKEQYANCAEDEIAYKKTQNCEIEQHTLPD--------GQVIS 232

  Fly   237 VPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARL 298
            : |..|.|..|.:|:.|   .|...:...::|.|...:.:..|.|:|:..|.||.:.:.|..:|.
plant   233 I-GRERYSVGEALFQPSILGLEEHGIVEQLVRIISTVSSENHRQLLENTVLCGGTTSMTGFESRF 296

  Fly   299 RQE-------LQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKE 356
            ::|       ::..|.:.|.|.....|             .::||:|||:.......|.:.:.|.
plant   297 QKEANLCSSAIRPTLVKPPEYMPENLG-------------MYSAWVGGAILAKVVFPQNQHVTKA 348

  Fly   357 TY 358
            .|
plant   349 DY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 77/372 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 82/392 (21%)
ARP7NP_567105.1 ACTIN 3..363 CDD:214592 82/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.