DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actb

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_112406.1 Gene:Actb / 81822 RGDID:628837 Length:375 Species:Rattus norvegicus


Alignment Length:385 Identity:83/385 - (21%)
Similarity:155/385 - (40%) Gaps:64/385 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR---------- 51
            :|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||          
  Rat     8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 72

  Fly    52 ---LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVS 113
               :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..|:..
  Rat    73 HGIVTNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 130

  Fly   114 SVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVE 178
            ::......:::|......|.:|:|.|...|..:|::.|..:..|.......|..:...:.:.|.|
  Rat   131 AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 195

  Fly   179 SGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPG 239
            .|...:...| .::.|||.:.|:|.   ..|.|.|.::....:....||...|...|:       
  Rat   196 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE------- 253

  Fly   240 LLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQE 301
              |....|.:|:.|   .|...:......||:.|.:|:|:.|..:..|.||.:|..|:..|:::|
  Rat   254 --RFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 316

  Fly   302 LQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361
            :..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Rat   317 ITALAP----------STMKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 78/362 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 83/385 (22%)
ActbNP_112406.1 PTZ00281 1..375 CDD:173506 83/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.