DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actr3

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001192314.1 Gene:Actr3 / 74117 MGIID:1921367 Length:418 Species:Mus musculus


Alignment Length:434 Identity:100/434 - (23%)
Similarity:168/434 - (38%) Gaps:97/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTG---------IRKRLFDYD---------TP 58
            |..|:|.||.|||||:|....|:.|:|:.:.:..:.         :.|.:.|.|         .|
Mouse     6 PACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKP 70

  Fly    59 E------------ELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFD 111
            .            |.:|.:..|::.:.||:|...|::..|:|.|....:...||..|.::|..|:
Mouse    71 TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFN 135

  Fly   112 VSSVLFVPVHLIALS-----------TLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGG 165
            |..:......::||:           ||   |..|:|.|...|.|:||..|..|          |
Mouse   136 VPGLYIAVQAVLALAASWTSRQVGERTL---TGTVIDSGDGVTHVIPVAEGYVI----------G 187

  Fly   166 SAI-HAEIKRQLVESGVKESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDV--DYI 227
            |.| |..|      :|...:...:.:|.|.:|......::|.|||   ..|......||:  ::.
Mouse   188 SCIKHIPI------AGRDITYFIQQLLRDREVGIPPEQSLETAKA---VKERYSYVCPDLVKEFN 243

  Fly   228 VSDNDA---VIQVPGLLRESAYEIMFEASNERDSLPHLILRS------------------ILDCT 271
            ..|.|.   :.|..|:...|..|...:...||...|.:....                  |.:|.
Mouse   244 KYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCP 308

  Fly   272 LDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFH-GELQFKFFNAV----GKQ 331
            :||||.|.:::.|.||.:|.:....||:::|:..:......:|... |.|:.|..:..    ..|
Mouse   309 IDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQ 373

  Fly   332 NFTAWLGGALCGATDLIQTRSLVKETYLKSEHVPDWSNLCDNRP 375
            .:..|.||::     |..|....:..:.|.::.....::|.:.|
Mouse   374 RYAVWFGGSM-----LASTPEFYQVCHTKKDYEEIGPSICRHNP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 94/397 (24%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 98/424 (23%)
Actr3NP_001192314.1 PTZ00280 2..417 CDD:240343 100/434 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.