DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actrt1

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_082790.1 Gene:Actrt1 / 73360 MGIID:1920610 Length:376 Species:Mus musculus


Alignment Length:387 Identity:87/387 - (22%)
Similarity:161/387 - (41%) Gaps:57/387 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV------VMTTTGIRKRLFDYDTPEELYDQLV-- 66
            :.|.::.|.|:...|:|.:.|..||.::.:.|      :.:....|||.|..:..:.:||.|.  
Mouse     8 DNPAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLH 72

  Fly    67 ---------------DFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVL 116
                           ...:.:|...|.|.|.|:...:.|........||....::|..|:|.: |
Mouse    73 YPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPQETREKTTEIMFEKFNVPA-L 136

  Fly   117 FVPVHLI-ALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVESG 180
            ::..|.: ||...|..|.||:|.|...|..:||:.|..:..|.......|..|...:.|.|:..|
Mouse   137 YLCNHAVGALCASACITGLVLDSGDGVTCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKG 201

  Fly   181 VK-ESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLLRES 244
            .. ..:|.::|::|||.:.|.|:...:...:......:....||.: .:..:|.:.|||      
Mouse   202 YTFPCILNKAVVDDIKEKLCTVSLGYKDTEKNCQQFLRKYTLPDGN-TIQMSDHLCQVP------ 259

  Fly   245 AYEIMFEASN---ERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLL 306
              |::|...:   ....:..::..||::|..|::..|...:.|.||.:|..||..||.:||:.|.
Mouse   260 --EVLFTPDHLGIHDLGISKMVCNSIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLA 322

  Fly   307 TE-DPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVPDW 367
            .| .|..            ..|...:.::||:||:      ::.:.:..|:.::.:|...::
Mouse   323 FEGTPIK------------ITASSDRCYSAWIGGS------VMTSMTTFKQMWVTAEDFKEY 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 84/357 (24%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 87/383 (23%)
Actrt1NP_082790.1 NBD_sugar-kinase_HSP70_actin 8..376 CDD:302596 87/387 (22%)
ACTIN 9..376 CDD:214592 87/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.