DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl10

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:349 Identity:79/349 - (22%)
Similarity:138/349 - (39%) Gaps:50/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQL-VDFLQTIFFKHLLVSPKERKFVLV 89
            |..|.|:|.|          .|:   :.|:|..|.|:::| |..||        |.|::...::.
Mouse    31 GGVARAHPIK----------HGV---VVDWDALEGLWERLMVGGLQ--------VHPEQWPVLVS 74

  Fly    90 ENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQI 154
            ::.......||.:|.:||....|.:.......|:||.::...:.|.|:.|.......|:::|...
Mouse    75 DSPSAPPKGREKVAELLFEALTVPACHMANTALLALCSIGAFSGLAVEAGAGVCHATPIYAGHSW 139

  Fly   155 MAAFKDQSYGGSAIHAEIKRQLVESGVKESL--LTESVLEDIKVRTCFVTTMERAKARANGDENQ 217
            ..|....:..||.:....:..||.:.....|  |:...:..:|.|.|:|:      ....||...
Mouse   140 HKATFRLNVAGSTLSRYFRDLLVAACPDLQLQGLSRKTVTQLKKRCCYVS------LDFQGDICD 198

  Fly   218 PTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALV 279
            |.......:.:. |...::: |..|....|.:|:.|   :....||.|..:::......:|..|.
Mouse   199 PARHQRACFCLG-NGCYVRL-GSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLA 261

  Fly   280 ESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAE-RFHG--ELQFKFFNAVGKQNFTAWLGGAL 341
            .:|.|.||.::..|.:.|:..||:         |: |.||  .||.......|:.. ..|.||::
Mouse   262 NTVVLAGGSTLFPGFVERMNLELE---------AQCRRHGYPALQPCLVAHPGRDT-AVWTGGSM 316

  Fly   342 CGATDLIQTRSLVKETYLKSEHVP 365
            ..:.:..|.|.:.:..|  .||.|
Mouse   317 MASLNSFQCRWMTRAMY--QEHGP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 72/322 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 79/349 (23%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 76/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.