DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl9

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 / 69481 MGIID:1916731 Length:415 Species:Mus musculus


Alignment Length:411 Identity:98/411 - (23%)
Similarity:167/411 - (40%) Gaps:91/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IYESVMQEK--------PP----IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIR-KRLFD 54
            :.:|:.|:.        ||    :|:|:||...|:|||.::     .||..|.|..|.: |:...
Mouse    28 VSKSLQQDSLSMVGDRLPPKTGAVVIDMGTGTCKVGFAGQS-----QPTYTVATILGCQPKKQAT 87

  Fly    55 YDTPE-------------ELYDQLVDFLQT----------IFFKHLL-----VSPKERKFVLVEN 91
            .|..|             ||  :||..::.          :.::|:|     |:..|...:..:.
Mouse    88 KDQSELETFIGEAARSRPEL--RLVKPIRNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDP 150

  Fly    92 VFGSTVLRETLARVLF--VHFDVSSVLFVPVHLIALSTLAV-----PTALVVDVGYSETSVMPVF 149
            .|.....||.|..|.|  :|   |..|:|    .:.|.|:|     ...||||.|:..:..:||.
Mouse   151 PFSPATNREKLVEVAFESLH---SPALYV----ASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVV 208

  Fly   150 SGVQIMAAFKDQSYGGSAIHAEIKRQLVESGVKESLLTE--SVLEDIKVRTCFVT-TMERAKARA 211
            .|..:..|.:.....|:.:.|.:...|:.||.  ||..|  .::|:||...|::. ..::.:||.
Mouse   209 QGYNLPHAIQRLDLAGNHLTAFLAEMLLGSGF--SLQQEDLDLVENIKHHYCYLAPDFQKEQARP 271

  Fly   212 NGDENQPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMFEASN----ERDSLPHLILRSILDCTL 272
            :.:..|....|| ...|:....:.|.|        |::|....    ....||.:..:|:|....
Mouse   272 DEECKQSLKLPD-GRTVTLGKELFQCP--------ELLFHPPEIPGLSPIGLPAMAEQSLLKVPQ 327

  Fly   273 DVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWL 337
            ::|..:..:|.|.||.|:..||..|.|.||.|.|:.:.......|           ..:|.:.|:
Mouse   328 ELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPEDHVVVMAH-----------PNRNLSVWI 381

  Fly   338 GGALCGATDLIQTRSLVKETY 358
            ||::..:....|:..:::|.|
Mouse   382 GGSILASLHAFQSCWVLREQY 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 92/383 (24%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 96/394 (24%)
Actl9NP_899105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ACTIN 48..414 CDD:214592 94/391 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.