DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actr10

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_062759.2 Gene:Actr10 / 56444 MGIID:1891654 Length:417 Species:Mus musculus


Alignment Length:400 Identity:163/400 - (40%)
Similarity:248/400 - (62%) Gaps:32/400 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIYESVMQ--EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRK--RLFDYD-TPEE 60
            ||:||.:..  ||..:|:|:|.|:||.|||.|..||.|:|:  |:...|:.|  ::..|: ..||
Mouse     1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPS--VIKRAGMSKPIKVVQYNINTEE 63

  Fly    61 LYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIAL 125
            ||..|.:|:..::|:||||:|::|:.|::|:|...:..||||.||||.:|:|.|||..|.||:||
Mouse    64 LYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMAL 128

  Fly   126 STLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVE-------SGVKE 183
            .||.:.:|:|:|.||.|:.|:|::.|:.|:..:.....||.|:|.|::.||:|       :...:
Mouse   129 LTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELETQLLEQCTVDTGAAKGQ 193

  Fly   184 SL------LTESVLEDIKVRTCFVTTMER------AKARANGDENQPTPAPDVDYIVSDNDAVIQ 236
            ||      :.|.||||||||||||:.::|      ||...:|:..:|||.|:|||.: |.:.::.
Mouse   194 SLPSVMGSVPEGVLEDIKVRTCFVSDLKRGLQIQAAKFNIDGNNERPTPPPNVDYPL-DGEKILH 257

  Fly   237 VPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQE 301
            |.|.:|:|..||:||..||..|:..|||.|:|.|.:|.|:.|.|::.::||.||:.|.|.||..|
Mouse   258 VLGSIRDSVVEILFEQDNEEKSVATLILDSLLQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAE 322

  Fly   302 LQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGA-TDLIQTRSLVKETYLKSEHVP 365
            :::|: |.|.|.:.. |...|:......|.|..||||||:.|| .|::.:||:.||.|.::..:|
Mouse   323 IRYLV-EKPKYKKTL-GTKNFRIHTPPAKANCVAWLGGAVFGALQDILGSRSISKEYYNQTGRIP 385

  Fly   366 DWSNLCDNRP 375
            ||.:|  |.|
Mouse   386 DWCSL--NNP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 142/350 (41%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 152/377 (40%)
Actr10NP_062759.2 Actin 13..364 CDD:330363 145/355 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10220
Inparanoid 1 1.050 279 1.000 Inparanoid score I2896
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56110
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 1 1.000 - - FOG0005826
OrthoInspector 1 1.000 - - oto91971
orthoMCL 1 0.900 - - OOG6_104680
Panther 1 1.100 - - LDO PTHR11937
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5702
SonicParanoid 1 1.000 - - X6314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.