DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actr8

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006519372.2 Gene:Actr8 / 56249 MGIID:1860775 Length:686 Species:Mus musculus


Alignment Length:351 Identity:68/351 - (19%)
Similarity:125/351 - (35%) Gaps:123/351 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KHLLVSPKERKF----VLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALV 135
            |:|.:..|:.|:    :|:.:::....::| |..::.:....:.::.....:.|.....:.:..|
Mouse   218 KYLEIPLKDLKYYRCILLIPDIYNKQHVKE-LVHMILMKMGFAGIVVHQESVCATFGSGLSSTCV 281

  Fly   136 VDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAI--------------HAE----------IKRQL 176
            ||||..:|||..|..||.........:||||.:              :.|          :.:.|
Mouse   282 VDVGDQKTSVCCVEDGVSHRNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHL 346

  Fly   177 VE---------SGVKE-----------SLLTESVLEDIKVRTCF--------------VTTMER- 206
            .|         ||:::           :||.:..|.|.|::...              :||::. 
Mouse   347 KETFCHLDQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHR 411

  Fly   207 ------------------------AKARAN-----------GD-ENQPTPAP------DVDYIVS 229
                                    |||.|:           || ..|.:..|      :||...|
Mouse   412 SQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLASS 476

  Fly   230 DNDAVI-------QVPGLLRESAYEIMFEASNERDSLPHLILRSILDC--TLDVRRALVESVFLV 285
            ..|.::       .:..|:.......:||  .:...|...||.|: ||  :.|.::.:..|:.:|
Mouse   477 QGDCLMAGNESEEALTALMSRKTAISLFE--GKALGLDKAILHSV-DCCSSDDTKKKMYSSILVV 538

  Fly   286 GGGSMVQGLLARLRQELQH-LLTEDP 310
            |||.|..    :.::.||| :|.:.|
Mouse   539 GGGLMFH----KAQEFLQHRILNKMP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 68/351 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 68/351 (19%)
Actr8XP_006519372.2 NBD_sugar-kinase_HSP70_actin 160..>400 CDD:388382 33/182 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.