DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACTR10

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_011535262.1 Gene:ACTR10 / 55860 HGNCID:17372 Length:424 Species:Homo sapiens


Alignment Length:407 Identity:161/407 - (39%)
Similarity:246/407 - (60%) Gaps:39/407 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIYESVMQ--EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRK--RLFDYD-TPEE 60
            ||:||.:..  ||..:|:|:|.|:||.|||.|..||.|:|:  |:...|:.|  |:..|: ..||
Human     1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPS--VIKRAGMPKPVRVVQYNINTEE 63

  Fly    61 LYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIAL 125
            ||..|.:|:..::|:||||:|::|:.|::|:|...:..||||.||||.:|:|.|||..|.||:||
Human    64 LYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMAL 128

  Fly   126 STLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVE------SGVKES 184
            .||.:.:|:|:|.||.|:.|:|::.|:.::..:.....||.|:|.|::.||:|      |..||.
Human   129 LTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTSVAKEQ 193

  Fly   185 LL-------TESVLEDI-------KVRTCFVTTMER------AKARANGDENQPTPAPDVDYIVS 229
            .|       .|.|||||       |.|||||:.::|      ||...:|:..:|:|.|:|||.: 
Human   194 SLPSVMGSVPEGVLEDIKGLLFFLKARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPL- 257

  Fly   230 DNDAVIQVPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGL 294
            |.:.::.:.|.:|:|..||:||..||..|:..|||.|::.|.:|.|:.|.|::.::||.||:.|.
Human   258 DGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGF 322

  Fly   295 LARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGA-TDLIQTRSLVKETY 358
            |.||..|:::|: |.|.|.:.. |...|:......|.|..||||||:.|| .|::.:||:.||.|
Human   323 LHRLLAEIRYLV-EKPKYKKAL-GTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYY 385

  Fly   359 LKSEHVPDWSNLCDNRP 375
            .::..:|||.:|  |.|
Human   386 NQTGRIPDWCSL--NNP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 140/357 (39%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 150/384 (39%)
ACTR10XP_011535262.1 NBD_sugar-kinase_HSP70_actin 12..389 CDD:302596 151/381 (40%)
Actin 14..395 CDD:278451 151/385 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10220
Inparanoid 1 1.050 277 1.000 Inparanoid score I2957
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56110
OrthoDB 1 1.010 - - D431718at33208
OrthoFinder 1 1.000 - - FOG0005826
OrthoInspector 1 1.000 - - oto88399
orthoMCL 1 0.900 - - OOG6_104680
Panther 1 1.100 - - LDO PTHR11937
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5702
SonicParanoid 1 1.000 - - X6314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.