DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and actr10

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001011001.1 Gene:actr10 / 496410 XenbaseID:XB-GENE-493723 Length:417 Species:Xenopus tropicalis


Alignment Length:400 Identity:159/400 - (39%)
Similarity:245/400 - (61%) Gaps:32/400 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIYESVMQ--EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRK--RLFDYD-TPEE 60
            ||:||.:..  ||..:|:|:|.|:||.|||.|..||.|:.:|:  ...|:.|  ::..|. ..||
 Frog     1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIRSEI--RKPGMSKPIKVVQYHINTEE 63

  Fly    61 LYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIAL 125
            ||..|::|:..::|:||||:|::|:.||:|:|...:..||||.||||.:|:|.||||.|.||::|
 Frog    64 LYSYLIEFIHMLYFRHLLVNPRDRRVVLIESVLSPSHFRETLTRVLFKYFEVPSVLFAPSHLMSL 128

  Fly   126 STLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVE-----SGVKE-- 183
            .||.:.:|:|:|.||:|:.|:|::.|:.|::.:.....||.|||.|::.||:|     :|..:  
 Frog   129 LTLGINSAMVLDCGYAESLVLPIYEGIPILSCWGALPMGGKAIHKELESQLLEECTANTGTAKDQ 193

  Fly   184 ------SLLTESVLEDIKVRTCFVTTMER------AKARANGDENQPTPAPDVDYIVSDNDAVIQ 236
                  |.::|.::||||||.|||:.::|      |:...:|...:|.|.|||||.: |...::.
 Frog   194 SLPSVMSSISEEIVEDIKVRICFVSDLQRGLKLQAARFNLDGTAERPIPPPDVDYPL-DGQKILH 257

  Fly   237 VPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQE 301
            |.|.:|:|..|::||..||..|:..|||.|::.|.:|.|:.|.|::.::||.:|:.|.|.||..|
 Frog   258 VKGSIRDSVAELLFEQDNEEKSVASLILDSLVQCPIDTRKQLAENLVIIGGTAMLPGFLHRLMAE 322

  Fly   302 LQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGA-TDLIQTRSLVKETYLKSEHVP 365
            : |.|.|.|.|.|....:: ||......|.|..||||||:.|| .|::.:||:.||.|.::..:|
 Frog   323 I-HYLVEKPKYKETLATKI-FKVHTPPAKPNCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIP 385

  Fly   366 DWSNLCDNRP 375
            ||  .|.|.|
 Frog   386 DW--CCLNNP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 138/350 (39%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 148/377 (39%)
actr10NP_001011001.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:388382 141/355 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10220
Inparanoid 1 1.050 279 1.000 Inparanoid score I2848
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D431718at33208
OrthoFinder 1 1.000 - - FOG0005826
OrthoInspector 1 1.000 - - oto102280
Panther 1 1.100 - - LDO PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.