DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Act87E

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:158/389 - (40%) Gaps:64/389 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR------ 51
            |...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||      
  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69

  Fly    52 -------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVH 109
                   :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..
  Fly    70 YPIEHGIITNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127

  Fly   110 FDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKR 174
            |:..::......:::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.:
  Fly   128 FNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMK 192

  Fly   175 QLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAVI 235
            .|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.|:....:....||...|...|:   
  Fly   193 ILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNE--- 254

  Fly   236 QVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLAR 297
                  |....|.:|:.|   .|...:...:..||:.|.:|:|:.|..::.:.||.:|..|:..|
  Fly   255 ------RFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADR 313

  Fly   298 LRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361
            :::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   314 MQKEITALAP----------STIKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 77/365 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 82/387 (21%)
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 83/389 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.